missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein Artikelnummer.: 30200510
Nur noch undefined auf Lager
Zum Warenkorb hinzufügen
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30200510

Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein

Artikelnummer. 30200510
100 μL, 100 Mikroliter
missing translation for 'orderingAttributeHoverText'
Menge:
100 μL
missing translation for 'unitSize'
100 Mikroliter
This item is not returnable. View return policy

Artikelnummer. 30200510

Marke: Invitrogen™ RP91392

Nur noch undefined auf Lager
Zum Warenkorb hinzufügen
Nur noch undefined auf Lager
Zum Warenkorb hinzufügen
This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64867 (PA5-64867, PA5-51512 (PA5-51512. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein remains unknown.
TRUSTED_SUSTAINABILITY

Specifications

Zugriffsnummer Q9Y3I0
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 51493
Name Human RTCB (aa 340-499) Control Fragment
Menge 100 μL
Kennzeichnung RUO
Gen-Alias 3'-phosphate/5'-hydroxy nucleic acid ligase; AI255213; AI463255; ankyrin repeat domain 54; C22orf28; C5H22orf28; D10Wsu52e; DJ149A16.6; FAAP; focal adhesion-associated protein; HAMAP-Rule:MF_03144}; HSPC117; hypothetical protein HSPC117; hypothetical protein LOC406376; hypothetical protein LOC525106; P55; RNA 2',3'-cyclic phosphate and 5'-OH ligase; RNA-splicing ligase RtcB homolog; RTCB; tRNA-splicing ligase RtcB homolog; tRNA-splicing ligase RtcB homolog {ECO:0000255; zgc:76871
Gebräuchliche Bezeichnung RTCB
Gensymbol Rtcb
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz PDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRP
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.