missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RPS28 Partial ORF (NP_001022, 1 a.a. - 55 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00006234-Q01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16134765

  • 547.00 CHF / 25 Mikrogramm
Verfügbar ab: 03-04-2024
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S28E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Sequence: MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDV
Spezifikation

Spezifikation

NP_001022
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.79kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDV
RUO
RPS28
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
6234
RPS28 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RPS28
Wheat Germ (in vitro)
GST
Liquid
Empfehlungen

Empfehlungen

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote