missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human RPL13 Full-length ORF (AAH13078, 1 a.a. - 211 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16130292
Nur noch undefined auf Lager
Zum Warenkorb hinzufügen

Abnova™ Human RPL13 Full-length ORF (AAH13078, 1 a.a. - 211 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16130292
10 ug, 10 Mikrogramm
Click to view available options
Menge:
10 ug
25 ug
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16130292

Marke: Abnova™ H00006137P01.10ug

Nur noch undefined auf Lager
Zum Warenkorb hinzufügen
Nur noch undefined auf Lager
Zum Warenkorb hinzufügen
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Used for AP, Array, ELISA, WB-Re

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas. Transcript variants derived from alternative splicing and/or alternative polyadenylation exist; these variants encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Sequence: MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARHIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKKK

Spezifikation

Zugriffsnummer AAH13078
Zur Verwendung mit (Anwendung) Antibody Production, Protein Array, ELISA, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 6137
Molekulargewicht 48.95kDa
Name RPL13 (Human) Recombinant Protein (P01)
Reinigungsverfahren Glutathione Sepharose 4 Fast Flow
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 10 ug
Immunogen MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARHIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKKK
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gen-Alias BBC1/D16S444E/FLJ27453/FLJ27454/MGC117342/MGC71373
Gebräuchliche Bezeichnung RPL13
Gensymbol RPL13
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Abnova™ Human RPL13 Full-length ORF (AAH13078, 1 a.a. - 211 a.a.) Recombinant Protein with GST-tag at N-terminal >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt