missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human RIN1 Partial ORF (AAH14417, 646 a.a. - 755 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16131036

Abnova™ Human RIN1 Partial ORF (AAH14417, 646 a.a. - 755 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16131036
25 μg, 25 Mikrogramm
Click to view available options
Menge:
10 μg
25 μg
Unit Size:
10 Mikrogramm
25 Mikrogramm
This item is not returnable. View return policy

Artikelnummer. 16131036

Marke: Abnova™ H00009610Q01.25ug

Dieser Artikel wurde eingestellt und ist leider nicht mehr verfügbar. Sehen Sie sich das Produkt an, um alternative Produktvorschläge zu sehen oder kontaktieren Sie unseren Technischen Support unter 056 618 41 11.
Alternative Produkte anzeigen

This item is not returnable. View return policy

Used for AP, Array, ELISA, WB-Re

Sequence: VPPEASIATLNQLCATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETT

Specifications

Zugriffsnummer AAH14417
Zur Verwendung mit (Anwendung) Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 9610
Molekulargewicht 37.73kDa
Name RIN1 (Human) Recombinant Protein (Q01)
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 25 μg
Immunogen VPPEASIATLNQLCATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETT
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gebräuchliche Bezeichnung RIN1
Gensymbol RIN1
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human RIN1 Partial ORF (AAH14417, 646 a.a. - 755 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.