Learn More
Abnova™ Human RGS6 Partial ORF (NP_004287, 207 a.a. - 306 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00009628-Q01.10ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
Members of the RGS (regulator of G protein signaling) family, such as RGS6, modulate G protein function by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits (Seki et al., 1999 [PubMed 10083744]).[supplied by OMIM]
Sequence: PGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLITPAEPSSpezifikation
NP_004287 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
PGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLITPAEPS | |
RUO | |
RGS6 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
9628 | |
RGS6 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DKFZp313G1241/FLJ43552/GAP/MGC142132 | |
RGS6 | |
Recombinant | |
wheat germ expression system |