missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human RASGRP3 Partial ORF (AAH27849, 581 a.a. - 690 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Menge:
10 μg
25 μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Beschreibung
Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RASGRP3, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM]
Sequence: AGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG
Spezifikation
Spezifikation
Zugriffsnummer | AAH27849 |
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 25780 |
Molekulargewicht | 37.73kDa |
Name | RASGRP3 (Human) Recombinant Protein (Q01) |
Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Menge | 25 μg |
Immunogen | AGHRDLDSRAITLVTGSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG |
Lagerungsbedingungen | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mehr anzeigen |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Abnova™ Human RASGRP3 Partial ORF (AAH27849, 581 a.a. - 690 a.a.) Recombinant Protein with GST-tag at N-terminal >
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur