missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human QSOX1 (aa 101-192) Control Fragment Recombinant Protein

Artikelnummer. 30181532
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30181532 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30181532 Lieferant Invitrogen™ Lieferanten-Nr. RP99851

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59881 (PA5-59881. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The QSOX1 gene, also known as Quiescin Q6, is a fusion of two ancient genes: thioredoxin and ERV1. Its expression is induced as fibroblasts begin to exit the proliferative cycle and enter quiescence, suggesting that this gene plays an important role in growth regulation. The QSOX1 protein oxidizes sulfhydryl groups to form disulfide bonds in proteins. QSOX1 expression is induced by hypoxia and appears to protect cells against oxidative stress-induced apoptosis.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer O00391
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 5768
Name Human QSOX1 (aa 101-192) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 1300003H02Rik; FAD-dependent sulfhydryl oxidase-2; hQSOX; mSOx; Q6; Qscn6; Qsox; QSO x 1; Quiescin Q6; quiescin Q6 sulfhydryl oxidase 1; quiescin sulfhydryl oxidase 1; RP11-502H18.3; rQSOX; rSOx; Skin sulfhydryl oxidase; Sox; So x 2; Sox-2; Sulfhydryl oxidase 1; testis tissue sperm-binding protein Li 62 n; thiol oxidase 1; UNQ2520/PRO6013
Gebräuchliche Bezeichnung QSOX1
Gensymbol Qsox1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz CAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIF
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.