missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PRSS27 Partial ORF (NP_114154, 94 a.a. - 203 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00083886-Q01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16150557

  • 458.00 CHF / 25 Mikrogramm


Verfügbar ab
24-02-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: QLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGY
Spezifikation

Spezifikation

NP_114154
Liquid
83886
PRSS27 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CAPH2|MPN
PRSS27
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGY
RUO
PRSS27
wheat germ expression system
Yes
Videos
Dokumentation