missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human PIK3C2B Partial ORF (NP_002637, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16129091

Abnova™ Human PIK3C2B Partial ORF (NP_002637, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16129091
25 ug, 25 Mikrogramm
Click to view available options
Menge:
10 µg
25 ug
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16129091

Marke: Abnova™ H00005287Q01.25ug

Dieser Artikel wurde eingestellt und ist leider nicht mehr verfügbar. Sehen Sie sich das Produkt an, um alternative Produktvorschläge zu sehen oder kontaktieren Sie unseren Technischen Support unter 056 618 41 11.
Alternative Produkte anzeigen

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is sensitive to low nanomolar levels of the inhibitor wortmanin. The C2 domain of this protein was shown to bind phospholipids but not Ca2+, which suggests that this enzyme may function in a calcium-independent manner. [provided by RefSeq]

Sequence: MSSTQDNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQG

Spezifikation

Zugriffsnummer NP_002637
Zur Verwendung mit (Anwendung) Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 5287
Molekulargewicht 37.84kDa
Name PIK3C2B (Human) Recombinant Protein (Q01)
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 25 ug
Immunogen MSSTQDNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISWDEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQG
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gen-Alias C2-PI3K/DKFZp686G16234
Gebräuchliche Bezeichnung PIK3C2B
Gensymbol PIK3C2B
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Abnova™ Human PIK3C2B Partial ORF (NP_002637, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt