missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PIAS1 Partial ORF (NP_057250, 476 a.a. - 565 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
361.00 CHF - 547.00 CHF
Spezifikation
| Zugriffsnummer | NP_057250 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 8554 |
| Molekulargewicht | 35.64kDa |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16118815
|
Abnova™
H00008554-Q01.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab: 30-05-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
|
16128815
|
Abnova™
H00008554-Q01.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab: 30-05-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Beschreibung
This gene encodes a member of the mammalian PIAS [protein inhibitor of activated STAT-1 (signal transducer and activator of transcription-1)] family. This member contains a putative zinc-binding motif and a highly acidic region. It inhibits STAT1-mediated gene activation and the DNA binding activity, binds to Gu protein/RNA helicase II/DEAD box polypeptide 21, and interacts with androgen receptor (AR). It functions in testis as a nuclear receptor transcriptional coregulator and may have a role in AR initiation and maintenance of spermatogenesis. [provided by RefSeq]
Sequence: SAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAASpezifikation
| NP_057250 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.64kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DDXBP1/GBP/GU/RH-II/MGC141878/MGC141879/ZMIZ3 | |
| PIAS1 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 8554 | |
| PIAS1 (Human) Recombinant Protein (Q01) | |
| SAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAA | |
| RUO | |
| PIAS1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |