missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PHC2 Full-length ORF (NP_004418.2, 1 a.a. - 323 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00001912-P01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16127297

  • 547.00 CHF / 25 Mikrogramm
Verfügbar ab: 21-08-2024
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

In Drosophila melanogaster, the 'Polycomb' group (PcG) of genes are part of a cellular memory system that is responsible for the stable inheritance of gene activity. PcG proteins form a large multimeric, chromatin-associated protein complex. The protein encoded by this gene has homology to the Drosophila PcG protein 'polyhomeotic' (Ph) and is known to heterodimerize with EDR1 and colocalize with BMI1 in interphase nuclei of human cells. The specific function in human cells has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKLPQQDHTTTTDSEMEEPYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLELPDMHMRDLVGMGHHFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS
Spezifikation

Spezifikation

NP_004418.2
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
62.2kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EDR2/HPH2/MGC163502/PH2
PHC2
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
1912
PHC2 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKLPQQDHTTTTDSEMEEPYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLELPDMHMRDLVGMGHHFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS
RUO
PHC2
Wheat Germ (in vitro)
GST
Liquid
Produktvorschläge

Produktvorschläge

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote