missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PFDN2 Full-length ORF (AAH12464, 1 a.a. - 154 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Menge:
10 ug
25μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Beschreibung
This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq]
Sequence: MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
Spezifikation
Spezifikation
Zugriffsnummer | AAH12464 |
Zur Verwendung mit (Anwendung) | Protein Array, ELISA, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 5202 |
Molekulargewicht | 42.68kDa |
Name | Human PFDN2 Full-length ORF (AAH12464, 1 a.a. - 154 a.a.) Recombinant Protein with GST-tag at N-terminal |
Reinigungsverfahren | Glutathione Sepharose 4 Fast Flow |
Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Menge | 25μg |
Lagerungsbedingungen | Store at −80°C. Aliquot to avoid repeated freezing and thawing. |
Mehr anzeigen |
Produktvorschläge
Customers who viewed this item also viewed.
Viewing 1-5 of 11
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Abnova™ Human PFDN2 Full-length ORF (AAH12464, 1 a.a. - 154 a.a.) Recombinant Protein with GST-tag at N-terminal >
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur