missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PCDH10 Partial ORF (NP_065866, 18 a.a. - 127 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Menge:
10 μg
25 μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Beschreibung
This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The mRNA encodes a cadherin-related neuronal receptor thought to play a role in the establishment and function of specific cell-cell connections in the brain. This family member contains 6 extracellular cadherin domains, a transmembrane domain and a cytoplasmic tail differing from those of the classical cadherins. Alternatively spliced transcripts encode isoforms with unique cytoplasmic domains. [provided by RefSeq]
Sequence: SQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDL
Spezifikation
Spezifikation
| Zugriffsnummer | NP_065866 |
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 57575 |
| Molekulargewicht | 37.84kDa |
| Name | PCDH10 (Human) Recombinant Protein (Q01) |
| Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Menge | 10 μg |
| Immunogen | SQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDL |
| Lagerungsbedingungen | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Mehr anzeigen |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Abnova™ Human PCDH10 Partial ORF (NP_065866, 18 a.a. - 127 a.a.) Recombinant Protein with GST-tag at N-terminal >
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur