missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PAPPA Partial ORF (NP_002572, 85 a.a. - 194 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00005069-Q01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16128701

  • 547.00 CHF / 25 Mikrogramm
Verfügbar ab: 26-06-2024
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

This gene encodes a secreted metalloproteinase which cleaves insulin-like growth factor binding proteins (IGFBPs). It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses. [provided by RefSeq]

Sequence: GATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPG
Spezifikation

Spezifikation

NP_002572
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPG
RUO
PAPPA
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
5069
PAPPA (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ASBABP2/DIPLA1/IGFBP-4ase/PAPA/PAPP-A/PAPPA1
PAPPA
Recombinant
wheat germ expression system
Produktvorschläge

Produktvorschläge

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote