missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human OSGEPL1 (aa 55-185) Control Fragment Recombinant Protein

Artikelnummer. 30195362
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30195362 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30195362 Lieferant Invitrogen™ Lieferanten-Nr. RP89224

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56541 (PA5-56541. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OSGEPL1, also known as Qri7, is a 414 amino acid protein that belongs to the KAE1/YgjD family and exists as 3 alternatively spliced isoforms. In tRNAs that have codons beginning with adenine, OSGEPL1 is required for the formation of a threonylcarbamoyl group on adenosine. The gene that encodes OSGEPL1 contains about 16,568 bases and maps to human chromosome 2q32.2. Consisting of 237 million bases, chromosome 2 encodes over 1,400 genes and makes up approximately 8% of the human genome. A number of genetic diseases are linked to genes on chromosome 2. Harlequin icthyosis, a rare and morbid skin deformity, is associated with mutations in the ABCA12 gene. The lipid metabolic disorder sitosterolemia is associated with ABCG5 and ABCG8. An extremely rare recessive genetic disorder, Alstrom syndrome, is due to mutations in the ALMS1 gene.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q9H4B0
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 64172
Name Human OSGEPL1 (aa 55-185) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 2610001M19Rik; AA416452; GCP1; HAMAP-Rule:MF_03179}; N6-L-threonylcarbamoyladenine synthase; OSGEPL1; O-sialoglycoprotein endopeptidase like 1; O-sialoglycoprotein endopeptidase-like 1; O-sialoglycoprotein endopeptidase-like protein 1; O-sialoglycoprotein endopeptidase-like protein 1 {ECO:0000255; probable O-sialoglycoprotein endopeptidase 2; probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial; probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial {ECO:0000255; probable tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1; putative sialoglycoprotease type 2; Qri7; t(6)A synthase; t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEPL1; t(6)A37 threonylcarbamoyladenosine biosynthesis protein Osgepl1 {ECO:0000255; tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1; tRNA threonylcarbamoyladenosine biosynthesis protein Osgepl1 {ECO:0000255
Gebräuchliche Bezeichnung OSGEPL1
Gensymbol OSGEPL1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz DETGNVLGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSD
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.