Learn More
Abnova™ Human OR2C3 Partial ORF (NP_932340.2, 220 a.a. - 319 a.a.) Recombinant Protein with GST-tag at N-terminal
Beschreibung
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]
Spezifikation
Spezifikation
| Zugriffsnummer | NP_932340.2 |
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 81472 |
| Molekulargewicht | 36.63kDa |
| Name | OR2C3 (Human) Recombinant Protein (Q01) |
| Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Menge | 10 μg |
| Immunogen | HIARAVLKIRSAEGRRKAFNTCSSHVAVVSLFYGSIIFMYLQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKSALRHMVLENCCGSAGKLAQI |
| Lagerungsbedingungen | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Mehr anzeigen |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.