missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NTNG2 Partial ORF (NP_115925, 21 a.a. - 119 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00084628-Q01.10ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16150807

  • 302.00 CHF / 10 Mikrogramm


Verfügbar ab
16-01-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: ICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPL
Spezifikation

Spezifikation

NP_115925
Liquid
84628
NTNG2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0625|KIAA1857|LHLL9381|Lmnt2|MGC21884|NTNG1|bA479K20.1
NTNG2
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPL
RUO
NTNG2
wheat germ expression system
Yes
Videos
Dokumentation