missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NR1H4 Partial ORF (NP_005114, 363 a.a. - 472 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00009971-Q01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16151546

  • 458.00 CHF / 25 Mikrogramm


Verfügbar ab
07-01-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: TPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
Spezifikation

Spezifikation

NP_005114
Liquid
9971
NR1H4 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BAR|FXR|HRR-1|HRR1|MGC163445|RIP14
NR1H4
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
RUO
NR1H4
wheat germ expression system
Yes
Videos
Dokumentation