missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human NAV2 Partial ORF (NP_892009.2, 1878 a.a. - 1973 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00089797-Q01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
The vitamin A metabolite, all-trans retinoic acid (atRA), plays an important role in neuronal development, including neurite outgrowth. RAINB1 is an atRA-responsive gene.[supplied by OMIM]
Sequence: TGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVSSpezifikation
| NP_892009.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.3kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| TGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVS | |
| RUO | |
| NAV2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 89797 | |
| NAV2 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ10633/FLJ11030/FLJ23707/FLJ77876/HELAD1/KIAA1419/POMFIL2/RAINB1/STEERIN2/UNC53H2 | |
| NAV2 | |
| Recombinant | |
| wheat germ expression system |