Learn More
Abnova™ Human MYH16 Partial ORF (BAB15219.1, 396 a.a. - 495 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00084176-Q01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
The MYH16 gene, encoding a sarcomeric myosin heavy chain expressed in nonhuman primate masticatory muscles, is inactivated in humans. Stedman et al. (2004) [PubMed 15042088] hypothesized that the decrement in masticatory muscle size caused by the inactivation of MYH16 removed an evolutionary constraint on encephalization in early man.[supplied by OMIM]
Sequence: ASMETIQKSKMNAEAHVRKLEDSLSEANAKVAELERNQAEINAIRTRLQAENSELSREYEESQSRLNQILRIKTSLTSQVDDYKRQLDEESKSRSTAVVSSpezifikation
| BAB15219.1 | |
| Liquid | |
| 84176 | |
| MYH16 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ22037/MHC20/MYH16P/MYH5 | |
| MYH16 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| ASMETIQKSKMNAEAHVRKLEDSLSEANAKVAELERNQAEINAIRTRLQAENSELSREYEESQSRLNQILRIKTSLTSQVDDYKRQLDEESKSRSTAVVS | |
| RUO | |
| MYH16 | |
| Wheat Germ (in vitro) | |
| GST |