missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MUC1 Control Fragment Recombinant Protein

Artikelnummer. 30210312
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30210312

Marke: Invitrogen™ RP102279

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MUC1 (Mucin 1, Episialin, MAM-6, CA 15-3, PEM and EMA) is a large cell surface mucin glycoprotein expressed by most glandular and ductal epithelial cells and some hematopoietic cell lineages. MUC1 is a transmembrane glycoprotein with a large mucin-like extracellular domain that matures through several intermediate forms generated by proteolysis, and sequential addition and processing of numerous O-linked glycans that are heavily sialylated. MUC1 is highly polymorphic and each allele encodes a product that contains a different number of repeats (between 30 and 90) leading to large differences in molecular weight of the protein. MUC1 is expressed on most secretory epithelium, including mammary gland and some hematopoietic cells, and is expressed abundantly in >90% breast carcinomas and metastases. Transgenic MUC1 has been shown to associate with all four cebB receptors and localize with erbB1 (EGFR) in lactating glands. The MUC1 gene contains seven exons and produces several different alternatively spliced variants. Overexpression, aberrant intracellular localization, and changes in glycosylation of the MUC1 protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of the MUC1 gene have been reported, but the full-length nature of only some has been determined. Transgenic MUC-1 has been shown to associate with all four cebB receptors and localize with erbB1 (EGFR) in lactating glands.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P15941
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 4582
Name Human MUC1 Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias ADMCKD; ADMCKD1; Breast carcinoma-associated antigen DF3; CA 15-3; Cancer antigen 15-3; carcinoma-associated mucin; CD227; DF3 antigen; EMA; Episialin; H23 antigen; H23AG; J19; KL-6; Krebs von den Lungen-6; MAM6; MCD; MCKD; MCKD1; Medullary cystic kidney disease, autosomal dominant; Muc1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; MUC1-alpha; MUC1-beta; MUC1-CT; MUC1-NT; mucin 1, cell surface associated; mucin 1, transmembrane; Mucin1; mucin-1; Mucin-1 subunit alpha; Mucin-1 subunit beta; peanut-reactive urinary mucin; PEM; PEMT; Polymorphic epithelial mucin; PUM; tumor associated epithelial mucin; tumor-associated epithelial membrane antigen; Tumor-associated mucin
Gebräuchliche Bezeichnung MUC1
Gensymbol MUC1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz ASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHGVTS
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt