missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30194381

Invitrogen™ Human MTFR1L (aa 207-286) Control Fragment Recombinant Protein

Artikelnummer. 30194381
Change view
Click to view available options
Menge:
100 μl
Unit Size:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge unitSize
30194381 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30194381 Supplier Invitrogen™ Supplier No. RP94156

om dit product te kopen Registreer vandaag om een webaccount aan te maken

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55512 (PA5-55512. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRUSTED_SUSTAINABILITY

Specifications

Zugriffsnummer Q9H019
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 56181
Name Human MTFR1L (aa 207-286) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias FAM54B; family with sequence similarity 54 member B; family with sequence similarity 54, member B; HYST1888; mitochondrial fission regulator 1 like; mitochondrial fission regulator 1-like; MST116; MSTP116; MTFR1L; protein FAM54B
Gebräuchliche Bezeichnung MTFR1L
Gensymbol MTFR1L
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz CSASPECCKPEHKAACSSSEEDDCVSLSKASSFADMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKFALKEED
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.