missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MTCP1 Full-length ORF (NP_001018024.1, 1 a.a. - 68 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
361.00 CHF - 547.00 CHF
Spezifikation
Zugriffsnummer | NP_001018024.1 |
---|---|
Zur Verwendung mit (Anwendung) | Antibody Production, Protein Array, ELISA, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 4515 |
Molekulargewicht | 34.1kDa |
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
---|---|---|---|---|---|---|---|---|---|
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
16130368
|
Abnova™
H00004515-P02.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab: 28-05-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
16140368
|
Abnova™
H00004515-P02.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab: 28-05-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Beschreibung
This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq]
Sequence: MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASKSpezifikation
NP_001018024.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.1kDa | |
Glutathione Sepharose 4 Fast Flow | |
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK | |
RUO | |
MTCP1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, Protein Array, ELISA, Western Blot | |
4515 | |
MTCP1 (Human) Recombinant Protein (P02) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
C6.1B/P13MTCP1 | |
MTCP1 | |
Recombinant | |
wheat germ expression system |