missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MOBKL1B Full-length ORF (AAH03398.1, 1 a.a. - 216 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

302.00 CHF - 458.00 CHF

Spezifikation

Name MOBKL1B (Human) Recombinant Protein (P01)
Rekombinant Yes
Reinigungsverfahren Glutathione Sepharose 4 Fast Flow
Zur Verwendung mit (Anwendung) Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Molekulargewicht 51.5kDa
Mehr Spezifikationen ansehen

Produkte 2
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
16161313 Unterlagen ansehen Abnova™
H00055233-P01.25UG
25 ug 458.00 CHF
25 Mikrogramm Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Verfügbar ab
05-08-2020
Zum Warenkorb hinzufügen
 
16151313 Unterlagen ansehen Abnova™
H00055233-P01.10UG
10 ug 302.00 CHF
10 Mikrogramm Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Verfügbar ab
05-08-2020
Zum Warenkorb hinzufügen
 
Beschreibung

Beschreibung

Sequence: MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
Spezifikation

Spezifikation

MOBKL1B (Human) Recombinant Protein (P01)
Glutathione Sepharose 4 Fast Flow
51.5kDa
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.