Learn More
Abnova™ Human MMP19 Full-length ORF (NP_002420.1, 1 a.a. - 508 a.a.) Recombinant Protein with GST-tag at N-terminal
Beschreibung
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This protein is expressed in human epidermis and it has a role in cellular proliferation as well as migration and adhesion to type I collagen. Multiple transcript variants encoding distict isoforms have been identified for this gene. [provided by RefSeq]
Spezifikation
Spezifikation
| Zugriffsnummer | NP_002420.1 |
| Zur Verwendung mit (Anwendung) | Antibody Production, Protein Array, ELISA, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 4327 |
| Molekulargewicht | 83.8kDa |
| Name | MMP19 (Human) Recombinant Protein (P02) |
| Reinigungsverfahren | Glutathione Sepharose 4 Fast Flow |
| Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Menge | 25 ug |
| Immunogen | MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY |
| Mehr anzeigen |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.