missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MMACHC Full-length ORF (AAH06122.3, 1 a.a. - 225 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00025974-P01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16127952

  • 547.00 CHF / 25 Mikrogramm
Verfügbar ab: 26-06-2024
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: MFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP
Spezifikation

Spezifikation

AAH06122.3
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
51.7kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp564I122/FLJ25671/RP11-291L19.3
MMACHC
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
25974
MMACHC (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP
RUO
MMACHC
Wheat Germ (in vitro)
GST
Liquid
Produktvorschläge

Produktvorschläge

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote