missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human MCAT Full-length ORF (NP_055322.1, 1 a.a. - 180 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16128812
Verfügbar ab: 02-09-2025
Nur noch null auf Lager
Zum Warenkorb hinzufügen

Abnova™ Human MCAT Full-length ORF (NP_055322.1, 1 a.a. - 180 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16128812
25 μg, 25 Mikrogramm
Click to view available options
Menge:
10 μg
25 μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16128812

Marke: Abnova™ H00027349P01.25ug

Nur noch null auf Lager
Verfügbar ab: 02-09-2025
Zum Warenkorb hinzufügen
Nur noch null auf Lager
Zum Warenkorb hinzufügen
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGSTVSPEEFL

Spezifikation

Zugriffsnummer NP_055322.1
Zur Verwendung mit (Anwendung) Antibody Production, Protein Array, ELISA, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 27349
Molekulargewicht 45.6kDa
Name MCAT (Human) Recombinant Protein (P01)
Reinigungsverfahren Glutathione Sepharose 4 Fast Flow
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 25 μg
Immunogen MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGSTVSPEEFL
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gen-Alias FASN2C/MCT/MGC47838/MT/fabD
Gebräuchliche Bezeichnung MCAT
Gensymbol MCAT
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Abnova™ Human MCAT Full-length ORF (NP_055322.1, 1 a.a. - 180 a.a.) Recombinant Protein with GST-tag at N-terminal >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt