missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MBD3L1 Partial ORF (NP_660209.1, 1 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Menge:
10 μg
25 μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Beschreibung
This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein is localized to discrete areas in the nucleus, and expression appears to be restricted to round spermatids, suggesting that the protein plays a role in the postmeiotic stages of male germ cell development. [provided by RefSeq]
Sequence: MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDL
Spezifikation
Spezifikation
| Zugriffsnummer | NP_660209.1 |
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 85509 |
| Molekulargewicht | 37.73kDa |
| Name | MBD3L1 (Human) Recombinant Protein (Q01) |
| Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Menge | 10 μg |
| Immunogen | MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDL |
| Lagerungsbedingungen | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Mehr anzeigen |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Abnova™ Human MBD3L1 Partial ORF (NP_660209.1, 1 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal >
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur