missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MBD3L1 Partial ORF (NP_660209.1, 1 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
361.00 CHF - 547.00 CHF
Specifica
Zugriffsnummer | NP_660209.1 |
---|---|
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 85509 |
Molekulargewicht | 37.73kDa |
Codice del prodotto | Marca | Menge | Prezzo | Quantità e disponibilità | |||||
---|---|---|---|---|---|---|---|---|---|
Codice del prodotto | Marca | Menge | Prezzo | Quantità e disponibilità | |||||
16141047
|
Abnova™
H00085509-Q01.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab: 11-06-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
16131047
|
Abnova™
H00085509-Q01.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab: 11-06-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Descrizione
This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein is localized to discrete areas in the nucleus, and expression appears to be restricted to round spermatids, suggesting that the protein plays a role in the postmeiotic stages of male germ cell development. [provided by RefSeq]
Sequence: MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLSpecifica
NP_660209.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.73kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MBD3L/MGC138263/MGC138269 | |
MBD3L1 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
85509 | |
MBD3L1 (Human) Recombinant Protein (Q01) | |
MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDL | |
RUO | |
MBD3L1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |