missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MAGEA3 Partial ORF (NP_005353, 44 a.a. - 114 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00004102-Q01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16150935

  • 458.00 CHF / 25 Mikrogramm


Verfügbar ab
16-01-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA
Spezifikation

Spezifikation

NP_005353
Liquid
4102
MAGEA3 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HIP8|HYPD|MAGE3|MAGEA6|MGC14613
MAGEA3
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.55kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA
RUO
MAGEA3
wheat germ expression system
Yes
Videos
Dokumentation