missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human LAPTM5 Partial ORF (NP_006753.1, 207 a.a. - 262 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00007805-Q01.25ug
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
This gene encodes a transmembrane receptor that is associated with lysosomes. The encoded protein, also known as E3 protein, may play a role in hematopoiesis. [provided by RefSeq]
Sequence: KCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEVSpezifikation
NP_006753.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.9kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
KCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV | |
RUO | |
LAPTM5 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
7805 | |
LAPTM5 (Human) Recombinant Protein (Q01) | |
25 μg | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ97251/MGC125860/MGC125861 | |
LAPTM5 | |
Recombinant | |
wheat germ expression system |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur