missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human LAPTM5 Partial ORF (NP_006753.1, 207 a.a. - 262 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00007805-Q01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
This gene encodes a transmembrane receptor that is associated with lysosomes. The encoded protein, also known as E3 protein, may play a role in hematopoiesis. [provided by RefSeq]
Sequence: KCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEVSpezifikation
| NP_006753.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.9kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| KCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV | |
| RUO | |
| LAPTM5 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 7805 | |
| LAPTM5 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ97251/MGC125860/MGC125861 | |
| LAPTM5 | |
| Recombinant | |
| wheat germ expression system |