missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Lactoferrin (aa 614-675) Control Fragment Recombinant Protein

Artikelnummer. 30204536
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30204536

Marke: Invitrogen™ RP103365

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111498 (PA5-111498. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lactoferrin (LF) is an iron binding glycoprotein. LF consists of a single polypeptide chain (approximately 80 kDa) folded into two structurally homologous lobes, each of which can reversibly bind one ferric ion (Fe3+). LF is found in external fluids, including milk and mucosal secretions, and is a prominent component of secondary granuals of neutrophils. The protein demonstrates a broad spectrum of properties, including regulation of iron homeostasis, host defense against a broad range of microbial infections, anti-inflammatory activity, regulation of cellular growth and differentiation and protection against cancer development and metastasis. LTF acts as a major first line defense against microbial infections, partly due to its ability to efficiently bind to and hence remove Fe3+ from the environment, but studies have also shown that LTF possesses bactericidal properties and proteolytic activity, capable of cleaving arginine-rich sequences within microbial proteins. Three isoforms of LTF have been identified: LTF-alpha, LTF-beta and LTF-gamma and receptors for LTF are expressed in the gastrointestinal tract, by macrophages, lymphocytes, neutrophils and platelets and also by some bacteria.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P02788
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 4057
Name Human Lactoferrin (aa 614-675) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias Bovine Lactoferrin; CKRX; Csp82; epididymis luminal protein 110; GIG12; Growth-inhibiting protein 12; HEL110; HLF2; Kaliocin 1; Kaliocin1; kaliocin-1; lactoferricin; Lactoferricin H; Lactoferricin-B; Lactoferricin-H; Lactoferrin; lactoferroxin; LactoferroxinA; Lactoferroxin-A; LactoferroxinB; Lactoferroxin-B; LactoferroxinC; Lactoferroxin-C; Lactotransferrin; LF; Lfcin H; Lfcin-B; LfcinH; Lfcin-H; LTF; minisatellite 10 r detected by probe MMS10; MMS10R; Ms10r; N lobe; neutrophil lactoferrin; talalactoferrin
Gebräuchliche Bezeichnung Lactoferrin
Gensymbol LTF
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz PNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt