Learn More
Abnova™ Human KCNG3 Partial ORF (NP_579875, 23 a.a. - 121 a.a.) Recombinant Protein with GST-tag at N-terminal
Beschreibung
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member is a gamma subunit functioning as a modulatory molecule. Alternative splicing results in two transcript variants encoding distinct isoforms. [provided by RefSeq]
Spezifikation
Spezifikation
| Zugriffsnummer | NP_579875 |
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 170850 |
| Molekulargewicht | 36.63kDa |
| Name | KCNG3 (Human) Recombinant Protein (Q01) |
| Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Menge | 10 μg |
| Immunogen | SRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMS |
| Lagerungsbedingungen | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Mehr anzeigen |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.