missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KCNG1 (aa 1-40) Control Fragment Recombinant Protein

Artikelnummer. 30181657
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30181657 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30181657 Lieferant Invitrogen™ Lieferanten-Nr. RP98324

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58828 (PA5-58828. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Multiple alternatively spliced transcript variants have been found in normal and cancerous tissues.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q9UIX4
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 3755
Name Human KCNG1 (aa 1-40) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias AW536275; K13; KCNG; KCNG1; kH2; KV6.1; orthologue of H. sapiens potassium voltage-gated channel, subfamily G, member 1 (KCNG1); OTTMUSG00000016048; potassium channel KH2; potassium channel Kv6.1; potassium channel, voltage gated modifier subfamily G, member 1; potassium channel, voltage-gated modifier subfamily G, member 1; potassium voltage-gated channel modifier subfamily G member 1; potassium voltage-gated channel subfamily G member 1; potassium voltage-gated channel, subfamily G, member 1; voltage-gated potassium channel subunit Kv6.1
Gebräuchliche Bezeichnung KCNG1
Gensymbol KCNG1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFY
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.