missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human JAG2 Partial ORF (NP_002217.3, 869 a.a. - 966 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
361.00 CHF - 547.00 CHF
Spezifikation
| Zugriffsnummer | NP_002217.3 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 3714 |
| Molekulargewicht | 36.41kDa |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16140345
|
Abnova™
H00003714-Q02.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab: 29-05-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
|
16130345
|
Abnova™
H00003714-Q02.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab: 29-05-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Beschreibung
The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: GRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCLPRSGHLSpezifikation
| NP_002217.3 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.41kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HJ2/SER2 | |
| JAG2 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 3714 | |
| JAG2 (Human) Recombinant Protein (Q02) | |
| GRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCLPRSGHL | |
| RUO | |
| JAG2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |