Learn More
Abnova™ Human IL6ST Partial ORF (NP_002175, 23 a.a. - 122 a.a.) Recombinant Protein with GST-tag at N-terminal
Beschreibung
The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggested a critical role of the gene encoding this protein in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]
Spezifikation
Spezifikation
Zugriffsnummer | NP_002175 |
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 3572 |
Molekulargewicht | 36.74kDa |
Name | IL6ST (Human) Recombinant Protein (Q01) |
Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Menge | 10 µg |
Immunogen | ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS |
Lagerungsbedingungen | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mehr anzeigen |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.