missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IGHA1 Full-length ORF (AAH05951, 1 a.a. - 500 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00003493-P02.10ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16136681

  • 364.00 CHF / 10 Mikrogramm

Verfügbar ab: 28-04-2023
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: MDWTWSILFLVAAATGAQSQVHLVQSGAEVMSPGASVRVSCKTSGYAFHTYSIIWVRQAPGQGLEWMGWISPSSDNTRFAKKFQGRVTLTTDTSTSTVYMELRSLRSDDTAVYYCARRYCSYSSCQNDYYYYYMDVWGKGTTVTVSSASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPDRDLCGCYSVSSVLSGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQETIDRLAGKPTHVNVSVVMAEVDGTCY
Spezifikation

Spezifikation

AAH05951
Liquid
3493
IGHA1 (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue.
MDWTWSILFLVAAATGAQSQVHLVQSGAEVMSPGASVRVSCKTSGYAFHTYSIIWVRQAPGQGLEWMGWISPSSDNTRFAKKFQGRVTLTTDTSTSTVYMELRSLRSDDTAVYYCARRYCSYSSCQNDYYYYYMDVWGKGTTVTVSSASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPDRDLCGCYSVSSVLSGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQETIDRLAGKPTHVNVSVVMAEVDGTCY
RUO
IGHA1
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
80.74kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ14473/FLJ35065/FLJ35500/FLJ36402/FLJ39698/FLJ40001/FLJ41548/FLJ41552/FLJ41789/FLJ43248/FLJ43594/FLJ44293/FLJ46028/FLJ46621/FLJ46724/FLJ46811/FLJ46824/IgA1/MGC102857
IGHA1
Yes
wheat germ expression system
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote