missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HRB Full-length ORF (NP_004495.2, 1 a.a. - 562 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Menge:
10 ug
25 ug
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Beschreibung
The protein encoded by this gene is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. The encoded protein binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFGTTGKAPVGSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVFGTVPVVASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATAATFGTASMSMPTGFGTPAPYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL
Spezifikation
Spezifikation
| Zugriffsnummer | NP_004495.2 |
| Zur Verwendung mit (Anwendung) | Antibody Production, Protein Array, ELISA, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 3267 |
| Molekulargewicht | 84.7kDa |
| Name | HRB (Human) Recombinant Protein (P01) |
| Reinigungsverfahren | Glutathione Sepharose 4 Fast Flow |
| Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Menge | 10 ug |
| Lagerungsbedingungen | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ Human HRB Full-length ORF (NP_004495.2, 1 a.a. - 562 a.a.) Recombinant Protein with GST-tag at N-terminal >
Spot an opportunity for improvement?Share a Content Correction