missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HPS3 Partial ORF (NP_115759, 903 a.a. - 1004 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
361.00 CHF - 547.00 CHF
Spezifikation
| Zugriffsnummer | NP_115759 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 84343 |
| Molekulargewicht | 36.96kDa |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16150747
|
Abnova™
H00084343-Q01.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab: 05-06-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
|
16160747
|
Abnova™
H00084343-Q01.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab: 05-06-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Beschreibung
This gene encodes a protein containing a potential clathrin-binding motif, consensus dileucine signals, and tyrosine-based sorting signals for targeting to vesicles of lysosomal lineage. The encoded protein may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 3. Alternate splice variants exist, but their full length sequence has not been determined. [provided by RefSeq]
Sequence: EYEQCIDILLERCPEAVIPYANHELKEENRTLWWKKLLPELCQRIKCGGEKYQLYLSSLKETLSIVAVELELKDFMNVLPEDGTATFFLPYLLYCSRKKPLTSpezifikation
| NP_115759 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.96kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DKFZp686F0413/FLJ22704/SUTAL | |
| HPS3 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 84343 | |
| HPS3 (Human) Recombinant Protein (Q01) | |
| EYEQCIDILLERCPEAVIPYANHELKEENRTLWWKKLLPELCQRIKCGGEKYQLYLSSLKETLSIVAVELELKDFMNVLPEDGTATFFLPYLLYCSRKKPLT | |
| RUO | |
| HPS3 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |