Learn More
Abnova™ Human GUCA1A Partial ORF (NP_000400, 1 a.a. - 93 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
361.00 CHF - 547.00 CHF
Spezifikation
Zugriffsnummer | NP_000400 |
---|---|
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 2978 |
Molekulargewicht | 35.97kDa |
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
---|---|---|---|---|---|---|---|---|---|
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
16129084
|
Abnova™
H00002978-Q01.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab: 03-06-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
16139084
|
Abnova™
H00002978-Q01.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab: 03-06-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Descripción
This gene plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. The protein encoded by this gene, guanylyl cyclase activating protein 1 (GCAP1), mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia. [provided by RefSeq]
Sequence: MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLREspecificaciones
NP_000400 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.97kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
COD3/GCAP/GCAP1/GUCA/GUCA1 | |
GUCA1A | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
2978 | |
GUCA1A (Human) Recombinant Protein (Q01) | |
MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLR | |
RUO | |
GUCA1A | |
Wheat Germ (in vitro) | |
GST | |
Liquid |