Learn More
Invitrogen™ Human GPATCH1 (aa 221-314) Control Fragment Recombinant Protein
Recombinant Protein
Marke: Invitrogen™ RP98880
Beschreibung
Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60361 (PA5-60361. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Spezifikation
Q9BRR8 | |
Blocking Assay, Control | |
55094 | |
100 μL | |
1300003A17Rik; ECGP; evolutionarily conserved G patch domain containing; evolutionarily conserved G-patch domain containing; evolutionarily conserved G-patch domain-containing protein; G patch domain containing 1; G patch domain-containing protein 1; GPATC1; G-patch domain containing 1; Gpatch1 | |
GPATCH1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human GPATCH1 (aa 221-314) Control Fragment | |
RUO | |
GPATCH1 | |
Unconjugated | |
Recombinant | |
DVTPVDFTPKDNVHGLAYKGLDPHQALFGTSGEHFNLFSGGSERAGDLGEIGLNKGRKLGISGQAFGVGALEEEDDDIYATETLSKYDTVLKDE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.