missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30207245

Invitrogen™ Human GLRX (aa 57-88) Control Fragment Recombinant Protein

Artikelnummer. 30207245
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30207245

Marke: Invitrogen™ RP104818

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65437 (PA5-65437. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutaredoxin (Grx), also known as thiol transferase, is a small heat-stable oxidoreductase. Grxs form part of the glutaredoxin system, comprising NADPH, GSH and glutathione reductase, which transfers electrons from NADPH to glutaredoxins via GSH. First recovered in E.coli as GSH-dependent hydrogen donors for ribonucleotide reductase, Grx catalyzes GSH-disulfide oxidoreductase via two redox-active cysteine residues. The active sequence (Cys-Pro-Tyr-Cys) is conserved in a variety of species. The 12-kDa dithiol protein has a role in reduction of mixed disulfides in cells exposed to oxidative stress.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P35754
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 2745
Name Human GLRX (aa 57-88) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias C86710; D13Wsu156e; GLRX; Glrx1; GLRXL; glutaredoxin; glutaredoxin (thioltransferase); glutaredoxin 1; glutaredoxin 1 (thioltransferase); Glutaredoxin1; glutaredoxin-1; Grx; Grx 1; Grx1; MGC117; MGC117407; thiol disulfide oxidoreductase; thioltransferase; Thioltransferase 1; thioltransferase; TTase; Thioltransferase1; Thioltransferase-1; TTase; TTase 1; TTase1; TTase-1; TTF; Unknown (protein for MGC:133817)
Gebräuchliche Bezeichnung GLRX
Gensymbol GLRX
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz IQDYLQQLTGARTVPRVFIGKDCIGGCSDLVS
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt