missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GAPDH (aa 250-298) Control Fragment Recombinant Protein

Artikelnummer. 30197641
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30197641

Marke: Invitrogen™ RP105174

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GAPDH (Glyceraldehyde-3-phosphate dehydrogenase) is a catalytic enzyme commonly known to be involved in glycolysis. GAPDH exists as a tetramer of identical 37-kDa subunits and catalyzes the reversible reduction of 1,3-bisphosphoglycerate to glyceraldehyde 3-phosphophate in the presence of NADPH. Apart from playing a key role in glycolysis, GAPDH is ubiquitously expressed and displays other activities unrelated to its glycolytic function. GAPDH is reported to be involved in the processes of DNA replication, DNA repair, nuclear RNA export, membrane fusion and microtubule bundling. Studies provide evidence of GAPDH playing an essential part in gene expression observed in apoptosis and as part of the cellular phenotype of age-related neurodegenerative diseases. Further, GAPDH is involved in other cellular processes ranging from membrane fusion, and neuronal apoptosis in cancer. GAPDH is reported to bind to a variety of other proteins, including the amyloid precursor protein, mutations in which cause some forms of Alzheimer's disease (AD), and the polyglutamine tracts of Huntingtin, the protein product aberrant forms of which are causative of Huntington's disease. Associations between GAPDH, actin and tubulin have also be reported. Since GAPDH is expressed at high levels in most tissues, it is useful as protein loading control in Western Blot analysis.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer O14556, P04406
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 2597, 26330
Name Human GAPDH (aa 250-298) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 38 kDa BFA-dependent ADP-ribosylation substrate; aging-associated gene 9 protein; BARS-38; bb02e05; cb350; cb609; CDABP0047; EC 1.2.1.12; epididymis secretory protein Li 278; epididymis secretory sperm binding protein Li 162 eP; fb71f08; fk58c09; G3PD; G3PDH; GAPD; GAPD2; gapdh; GAPDH2; GAPDH-2; GAPDHS; Gapds; Gapd-s; glceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase, testis-specific; glyceraldehyde phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase (G3PDH); glyceraldehyde-3-phosphate dehydrogenase 2; glyceraldehyde-3-phosphate dehydrogenase GAPDH; glyceraldehyde-3-phosphate dehydrogenase like-17 protein; glyceraldehyde-3-phosphate dehydrogenase type 2; glyceraldehyde-3-phosphate dehydrogenase, spermatogenic; glyceraldehyde-3-phosphate dehydrogenase, testis-specific; glyceraldehyde-phosphate-dehydrogenase; glycerine aldehyde 3-phosphate dehydrogenase; HEL-S-162 eP; HEL-S-278; HGNC:4141; HSD35; HSD-35; I79_001391; KNC-NDS6; LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase, testis-specific; mg:bb02e05; MGC128279 protein; MGC88685; multifunctional protein, glycolytic enzyme; OK/SW-cl0.12; Peptidyl-cysteine S-nitrosylase GAPDH; similar to glyceraldehyde 3-phosphate dehydrogenase; spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2; Spermatogenic glyceraldehyde-3-phosphate dehydrogenase; Unknown (protein for IMAGE:8101613); unnamed protein product; wu:fb33a10; wu:fb71f08; wu:fk58c09; wu:ft80f05; zgc:76908
Gebräuchliche Bezeichnung GAPDH
Gensymbol GAPDH, GAPDHS
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz EKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAG
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt