Learn More
Abnova™ Human GALNT14 Partial ORF (NP_078848.2, 494 a.a. - 551 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00079623-Q01.10ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
GALNT14 (EC 2.4.1.41) belongs to a large subfamily of glycosyltransferases residing in the Golgi apparatus. GALNT enzymes catalyze the first step in the O-glycosylation of mammalian proteins by transferring N-acetyl-D-galactosamine (GalNAc) to peptide substrates.[supplied by OMIM]
Sequence: KNGDDRQQWTKTGSHIEHIASHLCLDTDMFGDGTENGKEIVVNPCESSLMSQHWDMVSSpezifikation
| NP_078848.2 | |
| Liquid | |
| 79623 | |
| GALNT14 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ12691/FLJ13977/GALNT15/GalNac-T10/GalNac-T14 | |
| GALNT14 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.12kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| KNGDDRQQWTKTGSHIEHIASHLCLDTDMFGDGTENGKEIVVNPCESSLMSQHWDMVS | |
| RUO | |
| GALNT14 | |
| Wheat Germ (in vitro) | |
| GST |