missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GALK1 Partial ORF (NP_000145, 181 a.a. - 279 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
361.00 CHF - 547.00 CHF
Specifications
Zugriffsnummer | NP_000145 |
---|---|
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 2584 |
Molekulargewicht | 36.63kDa |
Product Code | Brand | Menge | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Menge | Price | Quantity & Availability | |||||
16128474
|
Abnova™
H00002584-Q01.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab: 28-05-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
16118474
|
Abnova™
H00002584-Q01.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab: 28-05-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Description
Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population. [provided by RefSeq]
Sequence: PCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARSpecifications
NP_000145 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
GALK/GK1 | |
GALK1 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
2584 | |
GALK1 (Human) Recombinant Protein (Q01) | |
PCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRAR | |
RUO | |
GALK1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |