missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human Gage12B Full-Length Orf (Adr82812.1, 1 A.A.-117 A.A.) Recombinant Protein With Gst Tag At N-Terminal.

Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.

Marke:  Abnova™ H00729428-P01.10ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16130844

  • 433.00 CHF / 10 Mikrogramm

Verfügbar ab: 06-07-2022
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

  • Good Folding
  • Excellent amino acids labeling

Immunogen Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Spezifikation

Spezifikation

ADR82812.1
Liquid
729428
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC163246
GAGE12B
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
GAGE12B (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue
MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
RUO
GAGE12B
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote

For Research Use Only