Learn More
Abnova™ Human FOXP4 Partial ORF (NP_001012426.1, 586 a.a. - 679 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
361.00 CHF - 547.00 CHF
Spezifikation
Zugriffsnummer | NP_001012426.1 |
---|---|
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 116113 |
Molekulargewicht | 36.08kDa |
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
---|---|---|---|---|---|---|---|---|---|
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
16161507
|
Abnova™
H00116113-Q01.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab:
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
16151507
|
Abnova™
H00116113-Q01.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab:
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Beschreibung
This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. This gene may play a role in the development of tumors of the kidney and larynx. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. [provided by RefSeq]
Sequence: LNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEELSpezifikation
NP_001012426.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.08kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ40908/FLJ44184/hFKHLA | |
FOXP4 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
116113 | |
FOXP4 (Human) Recombinant Protein (Q01) | |
LNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEEL | |
RUO | |
FOXP4 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |