missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FLJ35409 Full-length ORF (NP_001001688.1, 1 a.a. - 173 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00400765-P01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16150634

  • 458.00 CHF / 25 Mikrogramm


Verfügbar ab
25-02-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: MGTGLVAVWHRPGTFLKEVGAGSDCSDVQSLWDASSALSSLPLPLGRVSNTNKRKARPPSQVSCEGVGARESLSLLLLRVFVCLFVCLFQILMDDKTTRICHLLAKRKPPPPHPSSMPGHSWGQSDVAGVGMPKMKLGRMTQSGRRGLGLQVSALASVGPHSFASFAPCLSFL
Spezifikation

Spezifikation

NP_001001688.1
Liquid
400765
FLJ35409 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MGTGLVAVWHRPGTFLKEVGAGSDCSDVQSLWDASSALSSLPLPLGRVSNTNKRKARPPSQVSCEGVGARESLSLLLLRVFVCLFVCLFQILMDDKTTRICHLLAKRKPPPPHPSSMPGHSWGQSDVAGVGMPKMKLGRMTQSGRRGLGLQVSALASVGPHSFASFAPCLSFL
RUO
FLJ35409
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
44.8kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ35409
wheat germ expression system
Yes
Videos
Dokumentation