missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FLJ20035 Full-length ORF (AAH20601.1, 1 a.a. - 183 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

302.00 CHF - 458.00 CHF

Spezifikation

Name FLJ20035 (Human) Recombinant Protein (P01)
Rekombinant Yes
Reinigungsverfahren Glutathione Sepharose 4 Fast Flow
Zur Verwendung mit (Anwendung) Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Molekulargewicht 47.2kDa
Mehr Spezifikationen ansehen

Produkte 2
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
16151573 Unterlagen ansehen Abnova™
H00055601-P01.25UG
25 ug 458.00 CHF
25 Mikrogramm Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Verfügbar ab
05-08-2020
Zum Warenkorb hinzufügen
 
16141573 Unterlagen ansehen Abnova™
H00055601-P01.10UG
10 ug 302.00 CHF
10 Mikrogramm Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Verfügbar ab
05-08-2020
Zum Warenkorb hinzufügen
 
Beschreibung

Beschreibung

Sequence: MKIMEDFTTFLRIVSKLADMNQEYQLPLSKIKFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVTLGTIGVNRSQAPVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSISVSLRELCENEDDNVVLAFEQLSTTFWEKLNKV
Spezifikation

Spezifikation

FLJ20035 (Human) Recombinant Protein (P01)
Glutathione Sepharose 4 Fast Flow
47.2kDa
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.