missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human ERMAP Partial ORF (NP_001017922, 376 a.a. - 475 a.a.) Recombinant Protein with GST-tag at N-terminal Artikelnummer.: 16151397

Abnova™ Human ERMAP Partial ORF (NP_001017922, 376 a.a. - 475 a.a.) Recombinant Protein with GST-tag at N-terminal

Artikelnummer. 16151397
25 μg, 25 Mikrogramm
Click to view available options
Menge:
10 μg
25 μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16151397

Marke: Abnova™ H00114625Q01.25ug

Dieser Artikel wurde eingestellt und ist leider nicht mehr verfügbar. Sehen Sie sich das Produkt an, um alternative Produktvorschläge zu sehen oder kontaktieren Sie unseren Technischen Support unter 056 618 41 11.
Alternative Produkte anzeigen

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: NKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF

Specifica

Zugriffsnummer NP_001017922
Zur Verwendung mit (Anwendung) Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 114625
Molekulargewicht 36.74kDa
Name ERMAP (Human) Recombinant Protein (Q01)
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 25 μg
Immunogen NKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Gen-Alias MGC118810/MGC118811/MGC118812/MGC118813/PRO2801/RD/SC
Gebräuchliche Bezeichnung ERMAP
Gensymbol ERMAP
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Expressionssystem wheat germ expression system
Form Liquid
Vedi altri risultati Mostra meno risultati
Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto
Abnova™ Human ERMAP Partial ORF (NP_001017922, 376 a.a. - 475 a.a.) Recombinant Protein with GST-tag at N-terminal >

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato